Purification and cloning of a novel antimicrobial peptide from salivary glands of the hard tick, Ixodes sinensis

Comp Biochem Physiol B Biochem Mol Biol. 2008 Apr;149(4):557-61. doi: 10.1016/j.cbpb.2007.10.002. Epub 2007 Oct 16.

Abstract

A novel antimicrobial peptide named as ixosin-B was isolated from the salivary glands of the hard tick, Ixodes sinensis, by gel filtration, ion exchange chromatography and reverse-phase high-performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined as QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY by Edman degradation. The cDNA encoding ixosin-B was cloned by cDNA library screening. The predicted protein from the cDNA sequence composed of 89 amino acids including mature ixosin-B. Purified ixosin-B exerted its antimicrobial activities against bacteria and fungi. No similarity was found by BLAST search to any database entries and, thus, our findings describe a novel antimicrobial peptide. It is also the fourth family of antimicrobial peptide from hard ticks.

Publication types

  • Research Support, Non-U.S. Gov't

MeSH terms

  • Amino Acid Sequence
  • Animals
  • Anti-Infective Agents / chemistry
  • Anti-Infective Agents / isolation & purification*
  • Anti-Infective Agents / pharmacology
  • Candida albicans / drug effects
  • Cloning, Molecular
  • DNA, Complementary / genetics
  • Erythrocytes / drug effects
  • Escherichia coli / drug effects
  • Female
  • Hemolysis / drug effects
  • Male
  • Microbial Sensitivity Tests
  • Molecular Sequence Data
  • Peptides / chemistry
  • Peptides / genetics*
  • Peptides / isolation & purification*
  • Peptides / pharmacology
  • Rabbits
  • Salivary Glands / chemistry*
  • Salivary Glands / metabolism
  • Staphylococcus aureus / drug effects
  • Ticks / genetics*

Substances

  • Anti-Infective Agents
  • DNA, Complementary
  • Peptides

Associated data

  • GENBANK/EU047746